PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000868419
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 365aa    MW: 40687.5 Da    PI: 8.128
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000868419genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.99.4e-54251521128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl++ 
  MDP0000868419  25 LPPGFRFHPTDEELVVHYLKKKATSAPLPV-AIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSg 119
                    79****************************.88***************988899***************************************997 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  MDP0000868419 120 DTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 152
                    8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-6520186IPR003441NAC domain
PROSITE profilePS5100561.85325186IPR003441NAC domain
PfamPF023653.3E-2826152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MECTDSSAGS QQQQHQQPPP PQPNLPPGFR FHPTDEELVV HYLKKKATSA PLPVAIIAEV  60
DLYKFDPWEL PAKATFGEQE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPVLTSGD  120
TQKVGVKKAL VFYGGKPPKG IKTNWIMHEY RLADNKPNNK PPGCDLGNKK NSMRLDDWVL  180
CRIYKKNNTH RPMDHEREDS MEDIMGPLMP PSISHVGHHQ NMKLHFPKSN SSYGPPFMEN  240
DQIFFDGIMS STDGSASTHQ LQLKRPIVPS WYWNNQEDDQ TAADPSSSKR IQLHQLDNGT  300
NSNGAGINGG STNNNSSSIA NLLSQLPQTP PLHQHAVLGS LGDGIFRTPY QLPGMNWYSE  360
SNLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-7591891168NO APICAL MERISTEM PROTEIN
1ut4_B5e-7591891168NO APICAL MERISTEM PROTEIN
1ut7_A5e-7591891168NO APICAL MERISTEM PROTEIN
1ut7_B5e-7591891168NO APICAL MERISTEM PROTEIN
4dul_A5e-7591891168NAC domain-containing protein 19
4dul_B5e-7591891168NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.98250.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981160.0KF198116.1 Malus hupehensis NAC domain protein (NAC32) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280984.10.0NAC domain-containing protein 18
SwissprotQ9LD441e-123NAC56_ARATH; NAC transcription factor 56
TrEMBLD9ZJA40.0D9ZJA4_MALDO; NAC domain class transcription factor
STRINGGLYMA12G34990.11e-162(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-122NAC domain containing protein 2